PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G113900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 243aa    MW: 27086.9 Da    PI: 10.68
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G113900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.9e-1276120147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r rW +eE++++++a  ++G + Wk+I + +  ++t  q++s+ qk+
  Seita.9G113900.1.p  76 RERWVAEEHDRFLHALVLFGRD-WKRIEAFVA-TKTSTQIRSHAQKH 120
                         78******************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-1470126IPR009057Homeodomain-like
PROSITE profilePS5129415.60971125IPR017930Myb domain
SMARTSM007171.1E-875123IPR001005SANT/Myb domain
TIGRFAMsTIGR015576.0E-1575123IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.1E-676120IPR009057Homeodomain-like
PfamPF002491.5E-976120IPR001005SANT/Myb domain
CDDcd001674.36E-778121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MFTHTLNTGA NSRTLKTQLS PPTGFYLCFF CCSIRKRDRQ SESERDIYTM MMAAPAKSIG  60
MAGKKPRKPY TITRPRERWV AEEHDRFLHA LVLFGRDWKR IEAFVATKTS TQIRSHAQKH  120
FLRAQKLGLS VAPLPHPRRA AAAGVRQADE TIQLPLSPDD PHFALVCSQQ GSSTLCAWDR  180
TVGLSLNLQH AGAACRQRAS SPSTPPDTDC ERLCIIASHR SRRIQGDHGG HVRSNPQSTQ  240
VF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5987422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.17e-27MYB_related family protein